| Name |
CRAMP 1-39 scrambled |
| Sequence |
KIGIEQLKGIKGIPEKRPGKRFKLVGEFSNQKALQKLQL |
| 3-letter-code |
Lys - Ile - Gly - Ile - Glu - Gln - Leu - Lys - Gly - Ile - Lys - Gly - Ile - Pro - Glu - Lys - Arg - Pro - Gly - Lys - Arg - Phe - Lys - Leu - Val - Gly - Glu - Phe - Ser - Asn - Gln - Lys - Ala - Leu - Gln - Lys - Leu - Gln - Leu |
| Molecular weight |
4419.33 |
| Counter ion |
TFA |
| Solubilization |
Soluble in pure water. |
| Description |
The anti-microbial peptide CRAMP corresponds to aa 135-173 of the mouse cathelicidin like protein (MCLP). This peptide is the scrambled version. |
| |
|
|
|
|
|
|
|
